General Information

  • ID:  hor003272
  • Uniprot ID:  P47969
  • Protein name:  Synenkephalin
  • Gene name:  PENK
  • Organism:  Cavia porcellus (Guinea pig)
  • Family:  Opioid neuropeptide precursor family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Cavia (genus), Caviidae (family), Hystricomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0001515 opioid peptide activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region; GO:0031410 cytoplasmic vesicle; GO:0034466 chromaffin granule lumen

Sequence Information

  • Sequence:  ECSQDCAACSYRLVRPGDLNFLACTLECEGQLPSLKIWETCKDLLQVSKQELPQEGASSLRESGKQDESHLLS
  • Length:  73(25-97)
  • Propeptide:  MARLLRLCTWLVALGPGLLATVQAECSQDCAACSYRLVRPGDLNFLACTLECEGQLPSLKIWETCKDLLQVSKQELPQEGASSLRESGKQDESHLLSKKYGGFMKRYGGFMKKVDELYPVEPEEEANGGEILTKRYGGFMKKDAEDGDALANSSDLLKELLGTGDDRDRENHHQEGGDSDEGVSKRYGGFMRGLKRSPQVEDEAKELQKRYGGFMRRVGRPEWWMDYQKRYGGFLKRFAEFLPSDEEGESYSKEV
  • Signal peptide:  MARLLRLCTWLVALGPGLLATVQA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  [Met-enkephalin]: Neuropeptide that competes with and mimic the effects of opiate drugs. They play a role in a number of physiologic functions, including pain perception and responses to stress.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  OPRD1, Oprm1
  • Target Unid:  A0A286XTF2, P97266
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  2-24; 6-28; 9-41
  • Structure ID:  AF-P47969-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor003272_AF2.pdbhor003272_ESM.pdb

Physical Information

Mass: 937157 Formula: C343H554N96O117S6
Absent amino acids: M Common amino acids: L
pI: 4.36 Basic residues: 8
Polar residues: 23 Hydrophobic residues: 21
Hydrophobicity: -44.52 Boman Index: -14071
Half-Life: 1 hour Half-Life Yeast: 30 min
Half-Life E.Coli: >10 hour Aliphatic Index 82.88
Instability Index: 7623.56 Extinction Coefficient cystines: 7365
Absorbance 280nm: 102.29

Literature

  • PubMed ID:  6316163
  • Title:  Isolation and Structural Organization of the Human Preproenkephalin B Gene